The FASTA format is perhaps the simplest text format for biological sequences that still allow some metadata for the sequence. NCBI
The first line is the description line and must start with a greater-than (”>”) symbol followed by a name that can not have spaces.
All other lines are assumed to be sequence data. Lower-case letters are accepted and assumed the same as upper-case.
Numbers are not permitted and are filtered by some tools. The sequence ends by a blank line. The sequence data can have
lines of varying length, but no
Sequences are expected to be in the standard IUPAC amino acid or nucleic acid codes.
Filename extensions “.fasta”, “.faa”, “.fa”, “.fas”, and “.fsa” are common for text files containing FASTA sequences.
A DNA sequence:
>myDNAname
agctactactgagtcatcgtgtatgcgtatgatcatctatgcgtagtcgtacgtatctattcgatcg
A protein sequence:
>myprotein_name
MNSERSDVTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRA
AHVQGGNSLQVLNFVIFPHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQ
QHLSWGGDFPEEAQPFFSPAFLWTRPQETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQ
LRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDLERKLTVVK